PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013592390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 361aa    MW: 40062.8 Da    PI: 8.6761
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013592390.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32214269156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  XP_013592390.1 214 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 269
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.78E-18211272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-28211272IPR009057Homeodomain-like
PROSITE profilePS5129415.204211271IPR017930Myb domain
TIGRFAMsTIGR015571.4E-26214269IPR006447Myb domain, plants
PfamPF002495.8E-8216267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MMVQKMEVDH AHKMQRCHEY AEALKEEQKK IQVFQRELPL CLELVTQAIE ACKKELSVTS  60
TTSERYSEQT ASVCGGPVLE EFIQIKKSNN EENGEHESPR EVEKSDVDSK KSDWLRSTHL  120
WNHSQDPDTT VVVAKKARVV EVKPNSHNRG GFQPFQKEQK RVFSETDLHP AVKATTPAPA  180
PATTTCSTTE VGGVDKAGEE QVQKQQLQTQ TQRKQRRCWS PELHRRFLHA LQQLGGSHVA  240
TPKQIRDHMK VDGLTNDEVK SHLQKYRLHT RRPATAQGNG NSQQPQLVVV GGIWVPSPQD  300
FPSPSDVANN KGDGVYAPVT SQAPVPPQSP KRSVERSSGR CNSPAASSST NTTTTSASPV  360
S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0638862e-63AY063886.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
GenBankAY0879932e-63AY087993.1 Arabidopsis thaliana clone 40196 mRNA, complete sequence.
GenBankAY0912412e-63AY091241.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592390.10.0PREDICTED: transcription factor LUX-like
TrEMBLA0A078HMN00.0A0A078HMN0_BRANA; BnaC06g30320D protein
TrEMBLA0A0D3CZ150.0A0A0D3CZ15_BRAOL; Uncharacterized protein
STRINGBra004330.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-119G2-like family protein